GADD45B (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GADD45B (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GADD45B (Myc-DDK tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GADD45B (mGFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GADD45B (GFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GADD45B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Lenti ORF particles, GADD45B (Myc-DDK tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GADD45B (mGFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of growth arrest and DNA-damage-inducible, beta (GADD45B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GADD45B (untagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GADD45B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human growth arrest and DNA-damage-inducible, beta (GADD45B),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
GADD45B (1-160) human recombinant protein, 0.5 mg
Expression Host | E. coli |
GADD45B (1-160) human recombinant protein, 0.1 mg
Expression Host | E. coli |
GADD45B MS Standard C13 and N15-labeled recombinant protein (NP_056490)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-GADD45B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GADD45B |
Transient overexpression of GADD45B (NM_015675) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of GADD45B (NM_015675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GADD45B (NM_015675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack