Products

Jump to Filters
View as table Download
RPL5 Rabbit Polyclonal Antibody
TA335157

USD 375.00

5 Days

Rabbit polyclonal Anti-RPL5 Antibody

Applications WB
Reactivities Arabidopsis thaliana, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP