Products

cDNA Clones (33)
RNAi (11)
Proteins (8)
Gene Expression (7)
Antibodies (6)
Jump to Filters
View as table Download
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734

USD 420.00

In Stock

RPL5 (Myc-DDK-tagged)-Human ribosomal protein L5 (RPL5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Rpl5 (BC026934) Mouse Tagged ORF Clone
MR204113

USD 68.00

USD 670.00

In Stock

Rpl5 (Myc-DDK-tagged) - Mouse ribosomal protein L5 (cDNA clone MGC:25420 IMAGE:2651564)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL5 (NM_000969) Human Tagged ORF Clone
RG210734

USD 460.00

In Stock

RPL5 (GFP-tagged) - Human ribosomal protein L5 (RPL5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl5 (NM_016980) Mouse Tagged ORF Clone
MR220782

USD 310.00

In Stock

Rpl5 (Myc-DDK-tagged) - Mouse ribosomal protein L5 (Rpl5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL5 Human Gene Knockout Kit (CRISPR)
KN410734

USD 1,290.00

2 Weeks

RPL5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN410734 is the updated version of KN210734.
Rpl5 Mouse Gene Knockout Kit (CRISPR)
KN515053

USD 1,290.00

2 Weeks

Rpl5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515053 is the updated version of KN315053.
Rpl5 (BC026934) Mouse Tagged ORF Clone
MG204113

USD 300.00

3 Weeks

Rpl5 (GFP-tagged) - Mouse ribosomal protein L5 (cDNA clone MGC:25420 IMAGE:2651564)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl5 (NM_016980) Mouse Tagged ORF Clone
MG220782

USD 340.00

3 Weeks

Rpl5 (GFP-tagged) - Mouse ribosomal protein L5 (Rpl5), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl5 (BC026934) Mouse Tagged ORF Clone
MR204113L3

USD 500.00

3 Weeks

Lenti ORF clone of Rpl5 (Myc-DDK-tagged) - Mouse ribosomal protein L5 (cDNA clone MGC:25420 IMAGE:2651564)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (BC026934) Mouse Tagged ORF Clone Lentiviral Particle
MR204113L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl5 (Myc-DDK-tagged) - Mouse ribosomal protein L5 (cDNA clone MGC:25420 IMAGE:2651564), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (BC026934) Mouse Tagged ORF Clone
MR204113L4

USD 500.00

3 Weeks

Lenti ORF clone of Rpl5 (mGFP-tagged) - Mouse ribosomal protein L5 (cDNA clone MGC:25420 IMAGE:2651564)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (BC026934) Mouse Tagged ORF Clone Lentiviral Particle
MR204113L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl5 (GFP-tagged) - Mouse ribosomal protein L5 (cDNA clone MGC:25420 IMAGE:2651564), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (NM_016980) Mouse Tagged ORF Clone
MR220782L3

USD 510.00

3 Weeks

Lenti ORF clone of Rpl5 (Myc-DDK-tagged) - Mouse ribosomal protein L5 (Rpl5)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (NM_016980) Mouse Tagged ORF Clone
MR220782L4

USD 510.00

3 Weeks

Lenti ORF clone of Rpl5 (mGFP-tagged) - Mouse ribosomal protein L5 (Rpl5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L5 (RPL5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L5 (RPL5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (NM_031099) Rat Tagged ORF Clone
RR207297

USD 420.00

4 Weeks

Rpl5 (Myc-DDK-tagged ORF) - Rat ribosomal protein L5 (Rpl5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl5 (NM_031099) Rat Tagged ORF Clone
RR207297L3

USD 640.00

9 Weeks

Lenti ORF clone of Rpl5 (Myc-DDK-tagged ORF) - Rat ribosomal protein L5 (Rpl5), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (NM_031099) Rat Tagged ORF Clone Lentiviral Particle
RR207297L3V

USD 850.00

13 Weeks

Lenti ORF particles, Rpl5 (Myc-DDK-tagged ORF) - Rat ribosomal protein L5 (Rpl5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (NM_031099) Rat Tagged ORF Clone
RR207297L4

USD 700.00

9 Weeks

Lenti ORF clone of Rpl5 (mGFP-tagged ORF) - Rat ribosomal protein L5 (Rpl5), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl5 (NM_031099) Rat Tagged ORF Clone Lentiviral Particle
RR207297L4V

USD 960.00

13 Weeks

Lenti ORF particles, Rpl5 (GFP-tagged ORF) - Rat ribosomal protein L5 (Rpl5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L1

USD 768.00

In Stock

Lenti ORF clone of Human ribosomal protein L5 (RPL5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RPL5 Rabbit Polyclonal Antibody
TA332482

USD 275.00

3 Weeks

Rabbit anti-RPL5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPL5
RPL5 (NM_000969) Human Over-expression Lysate
LY400352

USD 396.00

In Stock

Transient overexpression lysate of ribosomal protein L5 (RPL5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL5 (NM_000969) Human Tagged ORF Clone
RC210734L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L5 (RPL5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RPL5 Human siRNA Oligo Duplex (Locus ID 6125)
SR304110

USD 430.00

In Stock

RPL5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

RPL5 Rabbit Polyclonal Antibody
TA314454

USD 345.00

In Stock

Rabbit polyclonal anti-RPL5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL5.
RPL5 (N-term) Rabbit Polyclonal Antibody
AP53722PU-N

USD 450.00

2 Weeks

RPL5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 2~31 amino acids from the N-terminal region of Human RPL5.
RPL5 (NM_000969) Human Over-expression Lysate
LC400352

USD 121.00

In Stock

RPL5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
RPL5 (NM_000969) Human Untagged Clone
SC119571

USD 660.00

In Stock

RPL5 (untagged)-Human ribosomal protein L5 (RPL5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPL5 (NM_000969) Human Untagged Clone
SC322784

USD 660.00

In Stock

RPL5 (untagged)-Human ribosomal protein L5 (RPL5)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
RPL5 Rabbit Polyclonal Antibody
TA335158

USD 375.00

5 Days

Rabbit polyclonal Anti-Rpl5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rpl5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG
RPL5 (NM_000969) Human Recombinant Protein
TP761599

USD 215.00

In Stock

Purified recombinant protein of Human ribosomal protein L5 (RPL5), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
RPL5 Human qPCR Primer Pair (NM_000969)
HP200906

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene RPL5

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
RPL5 Rabbit Polyclonal Antibody
TA335157

USD 375.00

5 Days

Rabbit polyclonal Anti-RPL5 Antibody

Applications WB
Reactivities Arabidopsis thaliana, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP
RPL5 (1-297, His-tag) Human Protein
AR51601PU-N

USD 1,105.00

2 Weeks

RPL5 (1-297, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
RPL5 (1-297, His-tag) Human Protein
AR51601PU-S

USD 415.00

2 Weeks

RPL5 (1-297, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human RPL5 activation kit by CRISPRa
GA104146

USD 1,290.00

2 Weeks

RPL5 CRISPRa kit - CRISPR gene activation of human ribosomal protein L5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Rpl5 activation kit by CRISPRa
GA219509

USD 1,290.00

2 Weeks

Rpl5 CRISPRa kit - CRISPR gene activation of mouse ribosomal protein L5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
RPL5 Human qPCR Template Standard (NM_000969)
HK208446

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene RPL5

Application Plasmid of exact quantity for transcript copy number calculation
Rpl5 (NM_016980) Mouse Untagged Clone
MC209327

USD 420.00

4 Weeks

Rpl5 (untagged) - Mouse ribosomal protein L5 (Rpl5), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Rpl5 (BC026934) Mouse Untagged Clone
MC217741

USD 730.00

2 Weeks

Rpl5 (untagged) - Mouse ribosomal protein L5 (cDNA clone MGC:25420 IMAGE:2651564), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Rpl5 Mouse qPCR Primer Pair (NM_016980)
MP212894

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Rpl5

Rpl5 (NM_031099) Rat Untagged Clone
RN207297

USD 420.00

5 Weeks

Rpl5 (untagged ORF) - Rat ribosomal protein L5 (Rpl5), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin