Products

View as table Download

Rabbit Polyclonal MFI2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal MFI2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-MFI2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA

MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit
Conjugation Unconjugated
Immunogen MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Dog, Elephant, Panda, Horse, Rabbit (100%); Bovine, Hamster, Pig (93%); Rat, Turkey, Chicken, Platypus (87%).

MELTF rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MELTF