Rabbit Polyclonal BACE Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | BACE antibody was raised against a peptide corresponding to 17 amino acids at the carboxy terminus of human BACE. |
Rabbit Polyclonal BACE Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | BACE antibody was raised against a peptide corresponding to 17 amino acids at the carboxy terminus of human BACE. |
Rabbit Polyclonal Anti-BACE1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY |
Rabbit Polyclonal Anti-BACE1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | BACE1 / BACE antibody was raised against synthetic 15 amino acid peptide from internal region of human BACE1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Guinea pig (100%); Platypus (87%); Xenopus, Pufferfish, Zebrafish, Stickleback (80%). |
Anti-BACE1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human beta-site APP-cleaving enzyme 1 |
BACE1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-322 of human BACE1 (NP_036236.1). |
Modifications | Unmodified |