Products

View as table Download

Rabbit polyclonal CPB1 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CPB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 9-37 amino acids from the N-terminal region of human CPB1.

Rabbit Polyclonal Anti-CPB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPB1 antibody: synthetic peptide directed towards the N terminal of human CPB1. Synthetic peptide located within the following region: SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL

Rabbit Polyclonal Anti-CPB1 Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPB1

CPB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPB1

CPB1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 111-417 of human CPB1 (NP_001862.2).
Modifications Unmodified