Products

View as table Download

Rabbit Polyclonal Anti-DCXR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Goat Polyclonal Antibody against DCXR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1.

Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1)

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

DCXR rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

DCXR rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated