Products

View as table Download

USD 98.00

USD 390.00

In Stock

DCXR (Myc-DDK-tagged)-Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

DCXR (Myc-DDK-tagged)-Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, DCXR (Myc-DDK tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, DCXR (mGFP-tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR)

Tag C-Myc/DDK
Expression Host HEK293T

USD 68.00

USD 219.00

In Stock

Dcxr (Myc-DDK-tagged) - Mouse dicarbonyl L-xylulose reductase (Dcxr)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DCXR (GFP-tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DCXR - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400023 is the updated version of KN200023.

Dcxr - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN504354 is the updated version of KN304354.

Dcxr (GFP-tagged) - Mouse dicarbonyl L-xylulose reductase (Dcxr), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Dcxr (Myc-DDK-tagged) - Mouse dicarbonyl L-xylulose reductase (Dcxr)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Dcxr (Myc-DDK-tagged) - Mouse dicarbonyl L-xylulose reductase (Dcxr), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Dcxr (mGFP-tagged) - Mouse dicarbonyl L-xylulose reductase (Dcxr)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Dcxr (GFP-tagged) - Mouse dicarbonyl L-xylulose reductase (Dcxr), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DCXR (Myc-DDK tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DCXR (mGFP-tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DCXR (Myc-DDK tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DCXR (mGFP-tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DCXR (GFP-tagged) - Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Dcxr (Myc-DDK-tagged ORF) - Rat dicarbonyl L-xylulose reductase (Dcxr), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Dcxr (Myc-DDK-tagged ORF) - Rat dicarbonyl L-xylulose reductase (Dcxr), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Dcxr (Myc-DDK-tagged ORF) - Rat dicarbonyl L-xylulose reductase (Dcxr), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Dcxr (mGFP-tagged ORF) - Rat dicarbonyl L-xylulose reductase (Dcxr), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Dcxr (GFP-tagged ORF) - Rat dicarbonyl L-xylulose reductase (Dcxr), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-DCXR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

DCXR (untagged)-Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

DCXR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Dcxr (untagged) - Mouse dicarbonyl L-xylulose reductase (cDNA clone MGC:19047 IMAGE:4189635), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Goat Polyclonal Antibody against DCXR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1.

Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1)

L-xylulose reductase (1-244, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

L-xylulose reductase (1-244, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

DCXR CRISPRa kit - CRISPR gene activation of human dicarbonyl and L-xylulose reductase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Dcxr CRISPRa kit - CRISPR gene activation of mouse dicarbonyl L-xylulose reductase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene DCXR

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene DCXR

DCXR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

qSTAR qPCR primer pairs against Mus musculus gene Dcxr