Germany
Japan
United Kingdom
China
Products
View as table Download
Anti-GGA2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 |
Rabbit Polyclonal Anti-GGA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGA2 antibody is: synthetic peptide directed towards the N-terminal region of Human GGA2. Synthetic peptide located within the following region: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH |
Carrier-free (glycerol/BSA-free) GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GGA2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GGA2 |
GGA2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GGA2 |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GGA2
Reactivities
- Human