GPC3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPC3 |
GPC3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPC3 |
Rabbit anti-GPC3 Polyclonal Antibody
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GPC3 |
Rabbit polyclonal Anti-GPC3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
Mouse Monoclonal Glypican 3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
GPC3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPC3 |
Glypican 3 (GPC3) Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human Glypican 3 (Glypican 3 (GPC3)) (NP_004475.1). |
Modifications | Unmodified |
Glypican 3 (GPC3) Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human Glypican 3 (Glypican 3 (GPC3)) (NP_004475.1). |
Modifications | Unmodified |
Glypican 3 (GPC3) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human Glypican 3 (Glypican 3 (GPC3)) (NP_004475.1). |
Modifications | Unmodified |
GPC3 mouse monoclonal antibody,clone OTI1G5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
GPC3 mouse monoclonal antibody,clone OTI1G5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |