Rabbit Polyclonal Anti-HAMP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAMP antibody: synthetic peptide directed towards the N terminal of human HAMP. Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM |
Hepcidin-25 (hu) ELISA Kit
| Format | Kit of 96 Tests |
| Reactivities | Human |
Human Hepcidin-25 ELISA Kit
| Format | Kit of 96 Tests |
| Reactivities | Human |
HAMP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HAMP |
Germany
Japan
United Kingdom
China
