Germany
Japan
United Kingdom
China
HAMP (Myc-DDK-tagged)-Human hepcidin antimicrobial peptide (HAMP)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human hepcidin antimicrobial peptide (HAMP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, HAMP (Myc-DDK tagged) - Human hepcidin antimicrobial peptide (HAMP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, HAMP (mGFP-tagged) - Human hepcidin antimicrobial peptide (HAMP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
HAMP (GFP-tagged) - Human hepcidin antimicrobial peptide (HAMP)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hamp (GFP-tagged) - Mouse hepcidin antimicrobial peptide (Hamp), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hamp (Myc-DDK-tagged) - Mouse hepcidin antimicrobial peptide (Hamp)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hamp (Myc-DDK-tagged ORF) - Rat hepcidin antimicrobial peptide (Hamp), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human hepcidin antimicrobial peptide (HAMP), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
HAMP - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404620 is the updated version of KN204620.
Hamp - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507557 is the updated version of KN307557.
Lenti ORF clone of Hamp (Myc-DDK-tagged) - Mouse hepcidin antimicrobial peptide (Hamp)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hamp (Myc-DDK-tagged) - Mouse hepcidin antimicrobial peptide (Hamp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hamp (mGFP-tagged) - Mouse hepcidin antimicrobial peptide (Hamp)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hamp (GFP-tagged) - Mouse hepcidin antimicrobial peptide (Hamp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, HAMP (Myc-DDK tagged) - Human hepcidin antimicrobial peptide (HAMP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, HAMP (mGFP-tagged) - Human hepcidin antimicrobial peptide (HAMP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hamp (Myc-DDK-tagged ORF) - Rat hepcidin antimicrobial peptide (Hamp), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hamp (Myc-DDK-tagged ORF) - Rat hepcidin antimicrobial peptide (Hamp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hamp (mGFP-tagged ORF) - Rat hepcidin antimicrobial peptide (Hamp), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hamp (GFP-tagged ORF) - Rat hepcidin antimicrobial peptide (Hamp), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HAMP (untagged)-Human hepcidin antimicrobial peptide (HAMP)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human hepcidin antimicrobial peptide (HAMP), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of hepcidin antimicrobial peptide (HAMP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Hamp (untagged ORF) - Rat hepcidin antimicrobial peptide (Hamp), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-HAMP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAMP antibody: synthetic peptide directed towards the N terminal of human HAMP. Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM |
HAMP - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Hamp - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Hamp (untagged) - Mouse hepcidin antimicrobial peptide (Hamp), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human hepcidin antimicrobial peptide (HAMP), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Hamp (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Purified recombinant protein of Mouse hepcidin antimicrobial peptide (Hamp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Hamp1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
HEPC (HAMP) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 24~54 amino acids from the Central region of Human Hepcidin / HAMP |
3`UTR clone of hepcidin antimicrobial peptide (HAMP) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit polyclonal anti Hepcidin-25 (ms); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Thr-Asn-Phe-Pro-Ile-Cys-Leu-Phe-Cys-Cys- Lys-Cys-Cys-Lys-Asn-Ser-Ser-Cys-Gly-Leu-Cys-Cys-Ile-Thr-OH coupled to carrier protein. |
Purified recombinant protein of Human hepcidin antimicrobial peptide (HAMP)
| Tag | N-GST |
| Expression Host | E. coli |
HAMP CRISPRa kit - CRISPR gene activation of human hepcidin antimicrobial peptide
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Hamp CRISPRa kit - CRISPR gene activation of mouse hepcidin antimicrobial peptide
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HAMP
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene HAMP
HAMP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Hamp1
AAV ORF Particles, serotype AAV-2, Hamp (Myc-DDK-tagged) - Mouse hepcidin antimicrobial peptide (Hamp), 250ul, >10^13 TU/mL
- AAV ORF®
-
HAMP MS Standard C13 and N15-labeled recombinant protein (NP_066998)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Hepcidin-25 (hu) ELISA Kit
| Format | Kit of 96 Tests |
| Reactivities | Human |
Human Hepcidin-25 ELISA Kit
| Format | Kit of 96 Tests |
| Reactivities | Human |
Hepcidin-25 (ms) ELISA Kit
| Format | Kit of 96 Tests |
| Reactivities | Mouse |
Hepcidin-25 (rt) ELISA Kit
| Format | Kit of 96 Tests |
| Reactivities | Rat |
Active filters
Target Symbol
- HAMP