Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-LEG9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEG9 Antibody: A synthesized peptide derived from human LEG9 |
Rabbit polyclonal anti-Galectin-9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 344 of human Galectin-9 |
Rabbit Polyclonal Anti-LGALS9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGALS9 antibody is: synthetic peptide directed towards the middle region of Human LGALS9. Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV |
Rabbit Polyclonal Anti-LGALS9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGALS9 antibody: synthetic peptide directed towards the middle region of human LGALS9. Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LGALS9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human LGALS9 (NP_002299.2). |
| Modifications | Unmodified |
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Active filters
Target Symbol
- LGALS9
Reactivities
- Human