Products

View as table Download

Rabbit Polyclonal Anti-NMNAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NMNAT1 antibody: synthetic peptide directed towards the N terminal of human NMNAT1. Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

Carrier-free (BSA/glycerol-free) NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

NMNAT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NMNAT1 (NP_073624.2).
Modifications Unmodified

NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated