Rabbit Polyclonal Anti-PCSK6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: NYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGI |
PACE4 / PCSK6 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | PACE4 / PCSK6 antibody was raised against synthetic peptide PDCEPGTYFDSE from an internal region of human PCSK6 / PACE4 (NP_002561.1; NP_612192.1; NP_612195.1; NP_612197.1; NP_612196.1; NP_612198.2; NP_612193.1; NP_612194.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Panda (92%); Platypus, Poplar (83%). |
Rabbit Polyclonal Anti-PCSK6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR |
Germany
Japan
United Kingdom
China
