Products

View as table Download

Rabbit Polyclonal Anti-SLIT1 Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLIT1 antibody: synthetic peptide directed towards the middle region of human SLIT1. Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC

Rabbit Polyclonal Anti-SLIT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLIT1

SLIT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1315-1534 of human SLIT1 (NP_003052.2).
Modifications Unmodified