Products

Jump to Filters
View as table Download
Transketolase (TKT) Rabbit Monoclonal Antibody [Clone ID: OTIR4F5]
TA591022

USD 428.00

In Stock

Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Transketolase (TKT) Rabbit Polyclonal Antibody
TA346697

USD 475.00

5 Days

Rabbit Polyclonal Anti-TKT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKT antibody: synthetic peptide directed towards the N terminal of human TKT. Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
Transketolase (TKT) Mouse Monoclonal Antibody [Clone ID: OTI5H3]
CF500892

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TKT mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Transketolase (TKT) Rabbit Polyclonal Antibody
TA350534

USD 345.00

In Stock

Rabbit Polyclonal Anti-TKT Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TKT
TKT Rabbit Polyclonal Antibody
TA369419

USD 380.00

4 Weeks

TKT rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TKT
Transketolase (TKT) Rabbit Polyclonal Antibody
TA382557

USD 220.00

3 Weeks

TKT Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TKT (NP_001128527.1).
Modifications Unmodified
Transketolase (TKT) Mouse Monoclonal Antibody [Clone ID: OTI5H3]
TA500892

USD 379.00

In Stock

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Transketolase (TKT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H3]
TA500892AM

USD 420.00

4 Weeks

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Transketolase (TKT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H3]
TA500892BM

USD 420.00

4 Weeks

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Transketolase (TKT) Mouse Monoclonal Antibody [Clone ID: OTI5H3]
TA500892S

USD 159.00

2 Days

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated