Products

View as table Download

Rabbit Polyclonal Anti-ZFYVE27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFYVE27 antibody: synthetic peptide directed towards the middle region of human ZFYVE27. Synthetic peptide located within the following region: VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH

Rabbit Polyclonal Anti-ZFYVE27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFYVE27 antibody: synthetic peptide directed towards the C terminal of human ZFYVE27. Synthetic peptide located within the following region: TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

ZFYVE27 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ZFYVE27

ZFYVE27 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ZFYVE27

ZFYVE27 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 217-411 of human ZFYVE27 (NP_653189.3).
Modifications Unmodified

ZFYVE27 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 217-411 of human ZFYVE27 (NP_653189.3).
Modifications Unmodified