ZFYVE27 Rabbit Polyclonal Antibody

CAT#: TA335290

Rabbit Polyclonal Anti-ZFYVE27 Antibody

Product Images

WB Suggested Anti-ZFYVE27 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFYVE27 antibody: synthetic peptide directed towards the middle region of human ZFYVE27. Synthetic peptide located within the following region: VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: zinc finger FYVE-type containing 27
• Database Link:
  NP_001002261
  Entrez Gene 118813 Human
  UniProt ID Q5T4F4
• Background: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.
• Synonyms: PROTRUDIN; SPG33
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 82%; Yeast: 75%

Reference Data

• Protein Families: Transmembrane