Rabbit Polyclonal Anti-ARF1 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
Goat Polyclonal Antibody against ARF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1. |
Anti-ARF1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 100-115 amino acids of Human ADP-ribosylation factor 1 |
ARF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ARF1 |
| Modifications | Unmodified |
ARF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ARF1 (NP_001649.1). |
| Modifications | Unmodified |
ARF1 Rabbit polyclonal Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human ARF1 |
Germany
Japan
United Kingdom
China
