Products

View as table Download

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT

DPP6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DPP6