Products

View as table Download

PLCB1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCB1

Rabbit Polyclonal Anti-PLCB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT

Rabbit Polyclonal Anti-Plcb1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Plcb1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Plcb1. Synthetic peptide located within the following region: AALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTD