Germany
Japan
United Kingdom
China
Products
View as table Download
Goat Polyclonal Antibody against RPL17
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RYSLDPENPTKSC, from the N Terminus of the protein sequence according to NP_000976.1; NP_001030178.1. |
Rabbit polyclonal Anti-Rpl17 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rpl17 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK |
RPL17 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL17 |
RPL17 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human RPL17 (NP_000976.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RPL17
Reactivities
- Mouse