Products

Jump to Filters
View as table Download
SLC25A31 Rabbit Polyclonal Antibody
TA315869

USD 345.00

In Stock

Rabbit polyclonal anti-SLC25A31 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC25A31.
Slc25a31 Rabbit Polyclonal Antibody
TA335356

USD 375.00

5 Days

Rabbit Polyclonal Anti-Slc25a31 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Slc25a31 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV
SLC25A31 Rabbit Polyclonal Antibody
TA381609

USD 275.00

3 Weeks

SLC25A31 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A31 (NP_112581.1).
Modifications Unmodified