Products

View as table Download

ACSL3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACSL3

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

ACSL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 527-556 amino acids from the C-terminal region of human ACSL3

ACSL3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACSL3

ACSL3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-300 of human ACSL3 (NP_004448.2).
Modifications Unmodified