Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CXCL14 |
Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CXCL14 |
Anti-Human BRAK Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BRAK (CXCL14) |
Biotinylated Anti-Human BRAK Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BRAK (CXCL14) |
Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE |
Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
CXCL14 rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CXCL14 |
CXCL14 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 35-111 of human CXCL14 (NP_004878.2). |
Modifications | Unmodified |