Products

View as table Download

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL14

Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Biotinylated Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

CXCL14 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL14

CXCL14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-111 of human CXCL14 (NP_004878.2).
Modifications Unmodified