Products

View as table Download

USD 98.00

USD 390.00

In Stock

CXCL14 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CXCL14 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cxcl14 (GFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CXCL14 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402533 is the updated version of KN202533.

Cxcl14 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN504041 is the updated version of KN304041.

Lenti ORF clone of Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cxcl14 (GFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cxcl14 (mGFP-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cxcl14 (GFP-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CXCL14 (untagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL14

Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Cxcl14 (mGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14).

Tag Tag Free
Expression Host E. coli

Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14 / BRAK)

Tag Tag Free
Expression Host E. coli

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14 / BRAK)

Tag Tag Free
Expression Host E. coli

Cxcl14 (untagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CXCL14 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

qSTAR qPCR primer pairs against Homo sapiens gene CXCL14

Biotinylated Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14), full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli

For quantitative detection of human CXCL14 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for human CXCL14
Format 8x12 divisible strips
Reactivities Human

Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine CXCL14. 96wells/kit, with removable strips.

Assay Type Sandwich ELISA kit of Quantitative Detection for Bovine CXCL14
Format 8x12 divisible strips
Reactivities Bovine

Sandwich High Sensitivity ELISA kit for Quantitative Detection of horse equine CXCL14. 96wells/kit, with removable strips.

Assay Type Sandwich ELISA kit of Quantitative Detection for Equine CXCL14
Format 8x12 divisible strips
Reactivities Equine

Sandwich High Sensitivity ELISA kit for Quantitative Detection of Chinese hamster CXCL14. 96wells/kit, with removable strips.

Assay Type Sandwich ELISA kit of Quantitative Detection for Hamster CXCL14
Format 8x12 divisible strips
Reactivities Hamster

Sandwich High Sensitivity ELISA kit for Quantitative Detection of Pig porcine CXCL14. 96wells/kit, with removable strips.

Assay Type Sandwich ELISA kit of Quantitative Detection for Pig CXCL14
Format 8x12 divisible strips
Reactivities Pig

Sandwich High Sensitivity ELISA kit for Quantitative Detection of monkey primate CXCL14. 96wells/kit, with removable strips.

Assay Type Sandwich ELISA kit of Quantitative Detection for Monkey CXCL14
Format 8x12 divisible strips
Reactivities Monkey

CXCL14 CRISPRa kit - CRISPR gene activation of human C-X-C motif chemokine ligand 14

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Cxcl14 CRISPRa kit - CRISPR gene activation of mouse chemokine (C-X-C motif) ligand 14

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene CXCL14

Application Plasmid of exact quantity for transcript copy number calculation

CXCL14 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

qSTAR qPCR primer pairs against Mus musculus gene Cxcl14

Cxcl14 (untagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of chemokine (C-X-C motif) ligand 14 (CXCL14) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase