Germany
Japan
United Kingdom
China
CXCL14 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CXCL14 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cxcl14 (GFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXCL14 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402533 is the updated version of KN202533.
Cxcl14 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504041 is the updated version of KN304041.
Lenti ORF clone of Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Cxcl14 (GFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cxcl14 (mGFP-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cxcl14 (GFP-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CXCL14 (untagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Cxcl14 (mGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of chemokine (C-X-C motif) ligand 14 (CXCL14)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14 / BRAK)
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14 / BRAK)
| Tag | Tag Free |
| Expression Host | E. coli |
Cxcl14 (untagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CXCL14 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
qSTAR qPCR primer pairs against Homo sapiens gene CXCL14
Rabbit Polyclonal Anti-CXCL14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE |
Rabbit Polyclonal Anti-CXCL14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
For quantitative detection of human CXCL14 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for human CXCL14 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine CXCL14. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Bovine CXCL14 |
| Format | 8x12 divisible strips |
| Reactivities | Bovine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of horse equine CXCL14. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Equine CXCL14 |
| Format | 8x12 divisible strips |
| Reactivities | Equine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Chinese hamster CXCL14. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Hamster CXCL14 |
| Format | 8x12 divisible strips |
| Reactivities | Hamster |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Pig porcine CXCL14. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Pig CXCL14 |
| Format | 8x12 divisible strips |
| Reactivities | Pig |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of monkey primate CXCL14. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Monkey CXCL14 |
| Format | 8x12 divisible strips |
| Reactivities | Monkey |
CXCL14 CRISPRa kit - CRISPR gene activation of human C-X-C motif chemokine ligand 14
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cxcl14 CRISPRa kit - CRISPR gene activation of mouse chemokine (C-X-C motif) ligand 14
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CXCL14
| Application | Plasmid of exact quantity for transcript copy number calculation |
CXCL14 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
qSTAR qPCR primer pairs against Mus musculus gene Cxcl14
Cxcl14 (untagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of chemokine (C-X-C motif) ligand 14 (CXCL14) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Active filters
Target Symbol
- CXCL14