CXCL14 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CXCL14 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CXCL14 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Cxcl14 (GFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CXCL14 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cxcl14 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cxcl14 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cxcl14 (GFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CXCL14 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CXCL14 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cxcl14 (Myc-DDK-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cxcl14 (mGFP-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cxcl14 (GFP-tagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CXCL14 (untagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CXCL14 |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Cxcl14 (mGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of chemokine (C-X-C motif) ligand 14 (CXCL14)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14).
Tag | Tag Free |
Expression Host | E. coli |
Anti-Human BRAK Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BRAK (CXCL14) |
Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14 / BRAK)
Tag | Tag Free |
Expression Host | E. coli |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14 / BRAK)
Tag | Tag Free |
Expression Host | E. coli |
Cxcl14 (untagged) - Mouse chemokine (C-X-C motif) ligand 14 (Cxcl14), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CXCL14 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
qSTAR qPCR primer pairs against Homo sapiens gene CXCL14
Biotinylated Anti-Human BRAK Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BRAK (CXCL14) |
Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE |
Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14. Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
For quantitative detection of human CXCL14 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
Assay Type | Sandwich ELISA kit of Quantitative Detection for human CXCL14 |
Format | 8x12 divisible strips |
Reactivities | Human |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine CXCL14. 96wells/kit, with removable strips.
Assay Type | Sandwich ELISA kit of Quantitative Detection for Bovine CXCL14 |
Format | 8x12 divisible strips |
Reactivities | Bovine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of horse equine CXCL14. 96wells/kit, with removable strips.
Assay Type | Sandwich ELISA kit of Quantitative Detection for Equine CXCL14 |
Format | 8x12 divisible strips |
Reactivities | Equine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Chinese hamster CXCL14. 96wells/kit, with removable strips.
Assay Type | Sandwich ELISA kit of Quantitative Detection for Hamster CXCL14 |
Format | 8x12 divisible strips |
Reactivities | Hamster |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Pig porcine CXCL14. 96wells/kit, with removable strips.
Assay Type | Sandwich ELISA kit of Quantitative Detection for Pig CXCL14 |
Format | 8x12 divisible strips |
Reactivities | Pig |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of monkey primate CXCL14. 96wells/kit, with removable strips.
Assay Type | Sandwich ELISA kit of Quantitative Detection for Monkey CXCL14 |
Format | 8x12 divisible strips |
Reactivities | Monkey |
CXCL14 CRISPRa kit - CRISPR gene activation of human C-X-C motif chemokine ligand 14
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cxcl14 CRISPRa kit - CRISPR gene activation of mouse chemokine (C-X-C motif) ligand 14
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CXCL14
Application | Plasmid of exact quantity for transcript copy number calculation |
CXCL14 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
qSTAR qPCR primer pairs against Mus musculus gene Cxcl14
Cxcl14 (untagged ORF) - Rat chemokine (C-X-C motif) ligand 14 (Cxcl14), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of chemokine (C-X-C motif) ligand 14 (CXCL14) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |