Products

View as table Download

Rabbit Polyclonal Anti-Fgf3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Fgf3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR

Mouse monoclonal Anti-FGF3 Clone MSD1

Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated

Anti-FGF3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 226-239 amino acids of Human fibroblast growth factor 3

FGF3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF3

FGF3 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF3 (NP_005238.1).