Fgf3 Rabbit Polyclonal Antibody

CAT#: TA346397

Rabbit Polyclonal Anti-Fgf3 Antibody

Product Images

WB Suggested Anti-Fgf3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Rat Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fgf3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: fibroblast growth factor 3
• Database Link:
  NP_570830
  Entrez Gene 170633 Rat
• Background: The function of Fgf3 remains unknown.
• Synonyms: FGF-3; HBGF-3; INT2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%