Products

cDNA Clones (19)
RNAi (8)
Proteins (7)
Gene Expression (6)
Primary Antibodies (5)
Jump to Filters
View as table Download
FMNL2 Rabbit Polyclonal Antibody
TA337055

USD 402.00

5 Days

Rabbit Polyclonal FMNL2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 1-50 of human Formin-like protein 2 was used as the immunogen.
FMNL2 Rabbit Polyclonal Antibody
TA337941

USD 375.00

5 Days

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody is: synthetic peptide directed towards the middle region of Human FMNL2. Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ
FMNL2 Rabbit Polyclonal Antibody
TA342487

USD 375.00

5 Days

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2. Synthetic peptide located within the following region: MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKAR
FMNL2 Rabbit Polyclonal Antibody
TA366136

USD 380.00

4 Weeks

FMNL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FMNL2
FMNL2 Rabbit Polyclonal Antibody
TA370490

USD 380.00

4 Weeks

FMNL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FMNL2