Products

cDNA Clones (20)
RNAi (12)
Gene Expression (6)
Proteins (6)
Primary Antibodies (4)
Jump to Filters
View as table Download
GCAP2 (GUCA1B) Rabbit Polyclonal Antibody
TA372607

USD 380.00

4 Weeks

GUCA1B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GUCA1B
GCAP2 (GUCA1B) Rabbit Polyclonal Antibody
TA342731

USD 375.00

5 Days

Rabbit Polyclonal Anti-GUCA1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUCA1B antibody: synthetic peptide directed towards the N terminal of human GUCA1B. Synthetic peptide located within the following region: SGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN
GUCA1B Rabbit Polyclonal Antibody
TA368362

USD 380.00

4 Weeks

GUCA1B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GUCA1B
GCAP2 (GUCA1B) Rabbit Polyclonal Antibody
TA376874

USD 220.00

3 Weeks

GUCA1B Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GUCA1B (NP_002089.4).
Modifications Unmodified