Products

View as table Download

JUNB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human JUNB

Rabbit anti-JUNB polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanJunB around the phosphorylation site of serine 259 (P-V-SP-P-I).

Rabbit polyclonal JunB(Ser79) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JunB around the phosphorylation site of Serine 79.
Modifications Phospho-specific

Rabbit Polyclonal JunB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JunB

Rabbit Polyclonal JunB (Ser259) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JunB around the phosphorylation site of Serine 259
Modifications Phospho-specific

Rabbit anti-JUNB (Phospho-Ser259) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 259 (P-V-SP-P-I).
Modifications Phospho-specific

JUNB (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 256-284 amino acids from the Central region of Human Jun-B

Goat Anti-JUNB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLKAENAGLSSTAG, from the internal region of the protein sequence according to NP_002220.1.

Rabbit anti-JUNB (Phospho-Ser79) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 79 (G-A-SP-L-K).
Modifications Phospho-specific

Rabbit Polyclonal Anti-JUNB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-JUNB antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL

Rabbit Polyclonal Anti-JUNB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUNB antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKL

Rabbit Polyclonal Anti-JUNB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF

Rabbit Polyclonal Anti-JUNB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: VERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQ

Rabbit anti JunB (pS259) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti JunB (pS79) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

JUNB Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of mouse JUNB

JUNB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human JUNB

JunB Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human JunB (NP_002220.1).
Modifications Unmodified

JunB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human JunB (NP_002220.1).
Modifications Unmodified

JunB Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human JunB

JunB Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated