Germany
Japan
United Kingdom
China
JUNB (Myc-DDK-tagged)-Human jun B proto-oncogene (JUNB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human jun B proto-oncogene (JUNB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
JUNB (untagged)-Human jun B proto-oncogene (JUNB)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Junb (Myc-DDK-tagged) - Mouse Jun-B oncogene (Junb)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, JUNB (Myc-DDK tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, JUNB (mGFP-tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
JUNB (GFP-tagged) - Human jun B proto-oncogene (JUNB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
JUNB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN403595 is the updated version of KN203595.
Junb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508569 is the updated version of KN308569.
Junb (GFP-tagged) - Mouse Jun-B oncogene (Junb), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Junb (Myc-DDK-tagged) - Mouse Jun-B oncogene (Junb)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Junb (Myc-DDK-tagged) - Mouse Jun-B oncogene (Junb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Junb (mGFP-tagged) - Mouse Jun-B oncogene (Junb)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Junb (GFP-tagged) - Mouse Jun-B oncogene (Junb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human jun B proto-oncogene (JUNB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, JUNB (Myc-DDK tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human jun B proto-oncogene (JUNB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, JUNB (mGFP-tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Junb (Myc-DDK-tagged ORF) - Rat jun B proto-oncogene (Junb), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Junb (Myc-DDK-tagged ORF) - Rat jun B proto-oncogene (Junb), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Junb (Myc-DDK-tagged ORF) - Rat jun B proto-oncogene (Junb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Junb (mGFP-tagged ORF) - Rat jun B proto-oncogene (Junb), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Junb (GFP-tagged ORF) - Rat jun B proto-oncogene (Junb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Junb - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Human jun B proto-oncogene (JUNB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
JUNB (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Junb - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
JUNB - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
JUNB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene JUNB
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Lenti ORF clone of Human jun B proto-oncogene (JUNB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal JunB(Ser79) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunB around the phosphorylation site of Serine 79. |
| Modifications | Phospho-specific |
Rabbit Polyclonal JunB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB |
Rabbit Polyclonal JunB (Ser259) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB around the phosphorylation site of Serine 259 |
| Modifications | Phospho-specific |
Junb - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
JUNB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of jun B proto-oncogene (JUNB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Junb (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit anti-JUNB (Phospho-Ser259) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 259 (P-V-SP-P-I). |
| Modifications | Phospho-specific |
JUNB (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 256-284 amino acids from the Central region of Human Jun-B |
qSTAR qPCR primer pairs against Mus musculus gene Junb
Goat Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKAENAGLSSTAG, from the internal region of the protein sequence according to NP_002220.1. |
Rabbit anti-JUNB (Phospho-Ser79) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 79 (G-A-SP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKL |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: VERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQ |
Rabbit anti JunB (pS259) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- JUNB