JUNB (Myc-DDK-tagged)-Human jun B proto-oncogene (JUNB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
JUNB (Myc-DDK-tagged)-Human jun B proto-oncogene (JUNB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human jun B proto-oncogene (JUNB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
JUNB (untagged)-Human jun B proto-oncogene (JUNB)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Junb (Myc-DDK-tagged) - Mouse Jun-B oncogene (Junb)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, JUNB (Myc-DDK tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, JUNB (mGFP-tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
JUNB (GFP-tagged) - Human jun B proto-oncogene (JUNB)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
JUNB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Junb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Junb (GFP-tagged) - Mouse Jun-B oncogene (Junb), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Junb (Myc-DDK-tagged) - Mouse Jun-B oncogene (Junb)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Junb (Myc-DDK-tagged) - Mouse Jun-B oncogene (Junb), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Junb (mGFP-tagged) - Mouse Jun-B oncogene (Junb)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Junb (GFP-tagged) - Mouse Jun-B oncogene (Junb), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human jun B proto-oncogene (JUNB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, JUNB (Myc-DDK tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human jun B proto-oncogene (JUNB), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, JUNB (mGFP-tagged) - Human jun B proto-oncogene (JUNB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Junb (Myc-DDK-tagged ORF) - Rat jun B proto-oncogene (Junb), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Junb (Myc-DDK-tagged ORF) - Rat jun B proto-oncogene (Junb), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Junb (Myc-DDK-tagged ORF) - Rat jun B proto-oncogene (Junb), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Junb (mGFP-tagged ORF) - Rat jun B proto-oncogene (Junb), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Junb (GFP-tagged ORF) - Rat jun B proto-oncogene (Junb), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
JUNB rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human JUNB |
Junb - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
Lenti ORF clone of Human jun B proto-oncogene (JUNB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
JUNB (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Junb - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
Format | Retroviral plasmids |
Vector | pRFP-C-RS |
Rabbit anti-JUNB polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanJunB around the phosphorylation site of serine 259 (P-V-SP-P-I). |
JUNB - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
Format | Retroviral plasmids |
Vector | pRFP-C-RS |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
JUNB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
E. coli Selection | Ampicillin |
Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene JUNB
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Lenti ORF clone of Human jun B proto-oncogene (JUNB), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal JunB(Ser79) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunB around the phosphorylation site of Serine 79. |
Modifications | Phospho-specific |
Rabbit Polyclonal JunB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB |
Rabbit Polyclonal JunB (Ser259) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB around the phosphorylation site of Serine 259 |
Modifications | Phospho-specific |
Junb - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
JUNB HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of jun B proto-oncogene (JUNB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Junb (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit anti-JUNB (Phospho-Ser259) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 259 (P-V-SP-P-I). |
Modifications | Phospho-specific |
JUNB (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 256-284 amino acids from the Central region of Human Jun-B |
qSTAR qPCR primer pairs against Mus musculus gene Junb
Goat Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TLKAENAGLSSTAG, from the internal region of the protein sequence according to NP_002220.1. |
Rabbit anti-JUNB (Phospho-Ser79) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 79 (G-A-SP-L-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKL |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: VERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQ |
Rabbit anti JunB (pS259) Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |