Products

cDNA Clones (24)
RNAi (13)
Primary Antibodies (11)
Proteins (9)
Gene Expression (7)
Jump to Filters
View as table Download
KAT2B Rabbit Polyclonal Antibody
TA308325

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to PCAF (K(lysine) acetyltransferase 2B)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 767 and 832 of PCAF (Uniprot ID#Q92831)
KAT2B Rabbit Polyclonal Antibody
TA344545

USD 475.00

5 Days

Rabbit Polyclonal Anti-PCAF Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCAF antibody: synthetic peptide directed towards the C terminal of human PCAF. Synthetic peptide located within the following region: PGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSI
KAT2B Mouse Monoclonal Antibody [Clone ID: 15G10]
TA327982

USD 235.00

5 Days

Mouse Monoclonal anti-Acetylated Lysine Antibody

Applications IF, WB
Reactivities Acetylated lysine residues
Conjugation Unconjugated
KAT2B Rabbit Polyclonal Antibody
TA590645

USD 409.00

In Stock

Rabbit Polyclonal PCAF Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
KAT2B (C-term) Rabbit Polyclonal Antibody
AP53187PU-N

USD 450.00

2 Weeks

KAT2B (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 802-832 amino acids from the C-terminal region of human PCAF
KAT2B (N-term) Rabbit Polyclonal Antibody
AP53188PU-N

USD 450.00

2 Weeks

KAT2B (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 260-291 amino acids from the N-terminal region of human PCAF
KAT2B Rabbit Polyclonal Antibody
TA325604

USD 345.00

4 Weeks

Rabbit Polyclonal p300/CBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human PCAF.
KAT2B Rabbit Polyclonal Antibody
TA330554

USD 310.00

5 Days

Rabbit Polyclonal Anti-PCAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCAF antibody: synthetic peptide directed towards the N terminal of human PCAF. Synthetic peptide located within the following region: LFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAK
KAT2B Rabbit Polyclonal Antibody
TA359827

USD 360.00

5 Days

KAT2B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KAT2B
Kat2b Rabbit Polyclonal Antibody
TA363201

USD 360.00

5 Days

KAT2B Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse KAT2B
KAT2B Rabbit Polyclonal Antibody
TA377684

USD 220.00

3 Weeks

KAT2B Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 583-832 of human KAT2B (NP_003875.3).
Modifications Unmodified