Products

cDNA Clones (24)
RNAi (12)
Primary Antibodies (7)
Gene Expression (6)
Proteins (5)
Jump to Filters
View as table Download
NMBR Rabbit Polyclonal Antibody
TA314264

USD 345.00

In Stock

Rabbit polyclonal anti-NMBR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NMBR.
NMBR Rabbit Polyclonal Antibody
TA344313

USD 475.00

5 Days

Rabbit Polyclonal Anti-NMBR Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NMBR antibody: synthetic peptide directed towards the N terminal of human NMBR. Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
NMBR Rabbit Polyclonal Antibody
TA328625

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Bombesin Receptor 1

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KSAHNLPGEYNEHTKK, corresponding to amino acid residues 241-256 of human BB1.3rd intracellular loop.
NMBR Rabbit Polyclonal Antibody
TA340753

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-NMBR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NMBR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Panda, Bovine, Bat, Horse, Rabbit, Pig (100%); Marmoset, Rat, Hamster, Dog, Opossum (94%); Platypus (88%); Elephant, Xenopus (81%).
NMBR (N-term) Rabbit Polyclonal Antibody
AP52896PU-N

USD 450.00

2 Weeks

NMBR (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 1-30aa) of human Neuromedin B receptor
NMBR Rabbit Polyclonal Antibody
TA341019

USD 425.00

5 Days

Rabbit Polyclonal Anti-NMBR Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NMBR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Elephant, Bovine (89%); Rat, Panda, Dog, Bat, Rabbit, Pig, Platypus (84%).
NMBR Rabbit Polyclonal Antibody
TA384878

USD 380.00

4 Weeks

Neuromedin B Receptor Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic Peptide of NMBR