Products

cDNA Clones (37)
Proteins (23)
RNAi (6)
Primary Antibodies (5)
Gene Expression (5)
Jump to Filters
View as table Download
NT5C3 (NT5C3A) Rabbit Polyclonal Antibody
TA347623

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-NT5C3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3
NT5C3 (NT5C3A) Rabbit Polyclonal Antibody
TA330188

USD 375.00

5 Days

Rabbit Polyclonal Anti-NT5C3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII
NT5C3 (NT5C3A) Rabbit Polyclonal Antibody
TA360914

USD 360.00

5 Days

NT5C3A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NT5C3
NT5C3 (NT5C3A) Rabbit Polyclonal Antibody
TA379355

USD 220.00

3 Weeks

NT5C3A Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-336 of human NT5C3A (NP_001002010.1).
Modifications Unmodified
NT5C3 (NT5C3A) Rabbit Polyclonal Antibody
TA379356

USD 220.00

3 Weeks

NT5C3A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-336 of human NT5C3A (NP_001002010.1).
Modifications Unmodified