Products

View as table Download

NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3A (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3A (mGFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3A (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3A (mGFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3A (Myc-DDK tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3A (mGFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3 (Myc-DDK-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of NT5C3 (mGFP-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NT5C3 (mGFP-tagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

NT5C3 (GFP-tagged) - Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Nt5c3 (Myc-DDK-tagged ORF) - Rat 5'-nucleotidase, cytosolic III (Nt5c3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Nt5c3 (Myc-DDK-tagged ORF) - Rat 5'-nucleotidase, cytosolic III (Nt5c3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Nt5c3 (mGFP-tagged ORF) - Rat 5'-nucleotidase, cytosolic III (Nt5c3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Nt5c3 (GFP-tagged ORF) - Rat 5'-nucleotidase, cytosolic III (Nt5c3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NT5C3 (untagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-NT5C3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3

NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

NT5C3 (untagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

NT5C3 (untagged)-Human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY424319 is the same product as LY425069.

3`UTR clone of 5'-nucleotidase cytosolic III (NT5C3) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

Rabbit Polyclonal Anti-NT5C3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII

NT5C3A CRISPRa kit - CRISPR gene activation of human 5'-nucleotidase, cytosolic IIIA

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene NT5C3

Application Plasmid of exact quantity for transcript copy number calculation

qPCR primer pairs and template standards against Homo sapiens gene NT5C3

Application Plasmid of exact quantity for transcript copy number calculation

qPCR primer pairs and template standards against Homo sapiens gene NT5C3

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene NT5C3A

NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

NT5C3A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB