Products

cDNA Clones (40)
Proteins (21)
RNAi (12)
Gene Expression (8)
Primary Antibodies (5)
Assay Kits (1)
Jump to Filters
View as table Download
OIF (OGN) Rabbit Monoclonal Antibody [Clone ID: OTIR4H1]
TA591025

USD 428.00

In Stock

Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OIF (OGN) (C-term) Rabbit Polyclonal Antibody
AP52994PU-N

USD 450.00

2 Weeks

OIF (OGN) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 246-276 amino acids from the C-terminal region of Human Mimecan.
Ogn Rabbit Polyclonal Antibody
TA346479

USD 475.00

5 Days

Rabbit Polyclonal Anti-Ogn Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ogn antibody is: synthetic peptide directed towards the C-terminal region of Rat Ogn. Synthetic peptide located within the following region: LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK
Ogn Rabbit Polyclonal Antibody
TA360164

USD 360.00

5 Days

OGN Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OGN
OIF (OGN) Rabbit Polyclonal Antibody
TA379455

USD 220.00

3 Weeks

OGN Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-298 of human OGN (NP_148935.1).
Modifications Unmodified