Rabbit Polyclonal Anti-PAFAH1B2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B2 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B2. Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV |
PAFAH1B2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PAFAH1B2 |
PAFAH1B2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human PAFAH1B2 (NP_002563.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
