Products

cDNA Clones (46)
Proteins (18)
RNAi (12)
Gene Expression (8)
Antibodies (4)
Jump to Filters
View as table Download
PAFAH1B2 (NM_002572) Human Tagged ORF Clone
RC201313

USD 98.00

USD 390.00

In Stock

PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAFAH1B2 (NM_002572) Human Recombinant Protein
TP301313

USD 823.00

In Stock

Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa (PAFAH1B2)

Tag C-Myc/DDK
Expression Host HEK293T
PAFAH1B2 (NM_002572) Human Tagged ORF Clone Lentiviral Particle
RC201313L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAFAH1B2 (Myc-DDK tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAFAH1B2 (NM_002572) Human Tagged ORF Clone Lentiviral Particle
RC201313L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAFAH1B2 (mGFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Pafah1b2 (NM_008775) Mouse Tagged ORF Clone
MR202751

USD 68.00

USD 149.00

In Stock

Pafah1b2 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 (Pafah1b2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAFAH1B2 (NM_002572) Human Tagged ORF Clone
RG201313

USD 460.00

In Stock

PAFAH1B2 (GFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAFAH1B2 Human Gene Knockout Kit (CRISPR)
KN401313

USD 1,290.00

2 Weeks

PAFAH1B2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401313 is the updated version of KN201313.
Pafah1b2 Mouse Gene Knockout Kit (CRISPR)
KN512752

USD 1,290.00

2 Weeks

Pafah1b2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512752 is the updated version of KN312752.
Pafah1b2 (NM_008775) Mouse Tagged ORF Clone
MG202751

USD 300.00

3 Weeks

Pafah1b2 (GFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, alpha2 subunit (Pafah1b2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pafah1b2 (NM_008775) Mouse Tagged ORF Clone
MR202751L3

USD 500.00

3 Weeks

Lenti ORF clone of Pafah1b2 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 (Pafah1b2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pafah1b2 (NM_008775) Mouse Tagged ORF Clone Lentiviral Particle
MR202751L3V

USD 700.00

6 Weeks

Lenti ORF particles, Pafah1b2 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 (Pafah1b2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pafah1b2 (NM_008775) Mouse Tagged ORF Clone
MR202751L4

USD 500.00

3 Weeks

Lenti ORF clone of Pafah1b2 (mGFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 (Pafah1b2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pafah1b2 (NM_008775) Mouse Tagged ORF Clone Lentiviral Particle
MR202751L4V

USD 700.00

6 Weeks

Lenti ORF particles, Pafah1b2 (GFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 (Pafah1b2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_002572) Human Tagged ORF Clone
RC201313L3

USD 620.00

3 Weeks

Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_002572) Human Tagged ORF Clone Lentiviral Particle
RC201313L3V

USD 820.00

5 Weeks

Lenti ORF particles, PAFAH1B2 (Myc-DDK tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_002572) Human Tagged ORF Clone
RC201313L4

USD 620.00

3 Weeks

Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_002572) Human Tagged ORF Clone Lentiviral Particle
RC201313L4V

USD 820.00

7 Weeks

Lenti ORF particles, PAFAH1B2 (mGFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184748) Human Tagged ORF Clone
RC229565

USD 420.00

3 Weeks

PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAFAH1B2 (NM_001184748) Human Tagged ORF Clone
RC229565L3

USD 620.00

8 Weeks

Lenti-ORF clone of PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184748) Human Tagged ORF Clone Lentiviral Particle
RC229565L3V

USD 820.00

11 Weeks

Lenti ORF particles, PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184748) Human Tagged ORF Clone
RC229565L4

USD 620.00

8 Weeks

Lenti-ORF clone of PAFAH1B2 (mGFP-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184748) Human Tagged ORF Clone Lentiviral Particle
RC229565L4V

USD 820.00

11 Weeks

Lenti ORF particles, PAFAH1B2 (mGFP-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184747) Human Tagged ORF Clone
RC229600

USD 420.00

3 Weeks

PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAFAH1B2 (NM_001184747) Human Tagged ORF Clone
RC229600L3

USD 620.00

8 Weeks

Lenti-ORF clone of PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184747) Human Tagged ORF Clone Lentiviral Particle
RC229600L3V

USD 820.00

11 Weeks

Lenti ORF particles, PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184747) Human Tagged ORF Clone
RC229600L4

USD 620.00

8 Weeks

Lenti-ORF clone of PAFAH1B2 (mGFP-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184747) Human Tagged ORF Clone Lentiviral Particle
RC229600L4V

USD 820.00

11 Weeks

Lenti ORF particles, PAFAH1B2 (mGFP-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184746) Human Tagged ORF Clone
RC229680

USD 420.00

3 Weeks

PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAFAH1B2 (NM_001184746) Human Tagged ORF Clone
RC229680L3

USD 620.00

3 Weeks

Lenti-ORF clone of PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184746) Human Tagged ORF Clone Lentiviral Particle
RC229680L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184746) Human Tagged ORF Clone
RC229680L4

USD 620.00

3 Weeks

Lenti-ORF clone of PAFAH1B2 (mGFP-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184746) Human Tagged ORF Clone Lentiviral Particle
RC229680L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAFAH1B2 (mGFP-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_001184748) Human Tagged ORF Clone
RG229565

USD 460.00

3 Weeks

PAFAH1B2 (GFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAFAH1B2 (NM_001184747) Human Tagged ORF Clone
RG229600

USD 460.00

3 Weeks

PAFAH1B2 (GFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAFAH1B2 (NM_001184746) Human Tagged ORF Clone
RG229680

USD 460.00

4 Weeks

PAFAH1B2 (GFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pafah1b2 (NM_022387) Rat Tagged ORF Clone
RR208585

USD 420.00

4 Weeks

Pafah1b2 (Myc-DDK-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, beta subunit (Pafah1b2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pafah1b2 (NM_022387) Rat Tagged ORF Clone
RR208585L3

USD 640.00

8 Weeks

Lenti ORF clone of Pafah1b2 (Myc-DDK-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, beta subunit (Pafah1b2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pafah1b2 (NM_022387) Rat Tagged ORF Clone Lentiviral Particle
RR208585L3V

USD 850.00

12 Weeks

Lenti ORF particles, Pafah1b2 (Myc-DDK-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, beta subunit (Pafah1b2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pafah1b2 (NM_022387) Rat Tagged ORF Clone
RR208585L4

USD 700.00

8 Weeks

Lenti ORF clone of Pafah1b2 (mGFP-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, beta subunit (Pafah1b2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pafah1b2 (NM_022387) Rat Tagged ORF Clone Lentiviral Particle
RR208585L4V

USD 960.00

12 Weeks

Lenti ORF particles, Pafah1b2 (GFP-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, beta subunit (Pafah1b2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAFAH1B2 (NM_002572) Human Tagged ORF Clone
RC201313L1

USD 768.00

In Stock

Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAFAH1B2 (NM_002572) Human Untagged Clone
SC118559

USD 310.00

In Stock

PAFAH1B2 (untagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAFAH1B2 Rabbit Polyclonal Antibody
TA344310

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAFAH1B2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAFAH1B2 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B2. Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV
PAFAH1B2 (NM_002572) Human Tagged ORF Clone
RC201313L2

USD 620.00

3 Weeks

Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAFAH1B2 Human shRNA Plasmid Kit (Locus ID 5049)
TL310627

USD 815.00

In Stock

PAFAH1B2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
Pafah1b2 (NM_008775) Mouse Untagged Clone
MC202049

USD 210.00

In Stock

Pafah1b2 (untagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 (Pafah1b2), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PAFAH1B2 Human siRNA Oligo Duplex (Locus ID 5049)
SR303340

USD 430.00

In Stock

PAFAH1B2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PAFAH1B2 (NM_002572) Human Over-expression Lysate
LY419243

USD 396.00

5 Days

Transient overexpression lysate of platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Human PAFAH1B2 activation kit by CRISPRa
GA103371

USD 1,290.00

2 Weeks

PAFAH1B2 CRISPRa kit - CRISPR gene activation of human platelet activating factor acetylhydrolase 1b catalytic subunit 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Pafah1b2 activation kit by CRISPRa
GA203089

USD 1,290.00

2 Weeks

Pafah1b2 CRISPRa kit - CRISPR gene activation of mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector