Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PLD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the N terminal of human PLD2. Synthetic peptide located within the following region: MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQ |
Rabbit Polyclonal Anti-PLD2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the middle region of human PLD2. Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT |
PLD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PLD2 (NP_002654.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
