Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody

CAT#: TA332122

Rabbit Polyclonal Anti-PLD2 Antibody

Product Images

WB Suggested Anti-PLD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

• 

  Lanes: Lane 1: 22ug mouse liver cell lysate; Lane 2: 22ug mouse liver cell lysate; Lane 3: 22ug mouse liver cell lysate; Lane 4: 22ug mouse liver cell lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilu

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the middle region of human PLD2. Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: phospholipase D2
• Database Link:
  NP_002654
  Entrez Gene 18806 MouseEntrez Gene 5338 Human
  UniProt ID O14939
• Background: The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localizes to the peripheral membrane and may be involved in cytoskeletal organization, cell cycle control, transcriptional regulation, and/or regulated secretion. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
• Synonyms: choline phosphatase 2; phospholipase D2
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Pig: 92%; Rat: 92%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis, Ether lipid metabolism, Fc gamma R-mediated phagocytosis, Glycerophospholipid metabolism, GnRH signaling pathway, Metabolic pathways