Products

cDNA Clones (26)
RNAi (12)
Primary Antibodies (7)
Gene Expression (5)
Proteins (3)
Jump to Filters
View as table Download
TAF6L Rabbit Polyclonal Antibody
TA347744

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6L Antibody: A synthesized peptide derived from human TAF6L
TAF6L Rabbit Polyclonal Antibody
TA315084

USD 345.00

In Stock

Rabbit polyclonal anti-TAF6L antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAF6L.
Taf6l Rabbit Polyclonal Antibody
TA329306

USD 375.00

5 Days

Rabbit Polyclonal anti-Taf6l antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Taf6l antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS
TAF6L Rabbit Polyclonal Antibody
TA331161

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN
TAF6L Rabbit Polyclonal Antibody
TA343612

USD 310.00

5 Days

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN
TAF6L Rabbit Polyclonal Antibody
TA343613

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF6L antibody is: synthetic peptide directed towards the C-terminal region of Human TAF6L. Synthetic peptide located within the following region: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY
TAF6L Rabbit Polyclonal Antibody
TA382286

USD 275.00

3 Weeks

TAF6L Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TAF6L (NP_006464.1).
Modifications Unmodified