Products

cDNA Clones (26)
RNAi (12)
Antibodies (7)
Gene Expression (5)
Proteins (3)
Jump to Filters
View as table Download
Taf6l (NM_146092) Mouse Tagged ORF Clone
MR209448

USD 580.00

In Stock

Taf6l (Myc-DDK-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6L (NM_006473) Human Tagged ORF Clone
RC220716

USD 480.00

In Stock

TAF6L (Myc-DDK-tagged)-Human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF6L)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Taf6l Mouse Gene Knockout Kit (CRISPR)
KN517152

USD 1,290.00

2 Weeks

Taf6l - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN517152 is the updated version of KN317152.
Taf6l (NM_146092) Mouse Tagged ORF Clone
MG209448

USD 640.00

3 Weeks

Taf6l (GFP-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Taf6l (NM_001177798) Mouse Tagged ORF Clone
MG220223

USD 690.00

3 Weeks

Taf6l (GFP-tagged) - Mouse TAF6-like RNA polymerase II p300/CBP-associated factor (PCAF)-associated factor (Taf6l) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Taf6l (NM_146092) Mouse Tagged ORF Clone
MR209448L3

USD 780.00

3 Weeks

Lenti ORF clone of Taf6l (Myc-DDK-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_146092) Mouse Tagged ORF Clone Lentiviral Particle
MR209448L3V

USD 980.00

6 Weeks

Lenti ORF particles, Taf6l (Myc-DDK-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_146092) Mouse Tagged ORF Clone
MR209448L4

USD 780.00

3 Weeks

Lenti ORF clone of Taf6l (mGFP-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_146092) Mouse Tagged ORF Clone Lentiviral Particle
MR209448L4V

USD 980.00

6 Weeks

Lenti ORF particles, Taf6l (GFP-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_001177798) Mouse Tagged ORF Clone
MR220223

USD 630.00

4 Weeks

Taf6l (Myc-DDK-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Taf6l (NM_001177798) Mouse Tagged ORF Clone
MR220223L3

USD 830.00

4 Weeks

Lenti ORF clone of Taf6l (Myc-DDK-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_001177798) Mouse Tagged ORF Clone Lentiviral Particle
MR220223L3V

USD 1,030.00

7 Weeks

Lenti ORF particles, Taf6l (Myc-DDK-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_001177798) Mouse Tagged ORF Clone
MR220223L4

USD 830.00

4 Weeks

Lenti ORF clone of Taf6l (mGFP-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_001177798) Mouse Tagged ORF Clone Lentiviral Particle
MR220223L4V

USD 1,030.00

7 Weeks

Lenti ORF particles, Taf6l (GFP-tagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6L (NM_006473) Human Tagged ORF Clone
RC220716L3

USD 680.00

3 Weeks

Lenti-ORF clone of TAF6L (Myc-DDK-tagged)-Human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF6L)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6L (NM_006473) Human Tagged ORF Clone Lentiviral Particle
RC220716L3V

USD 880.00

6 Weeks

Lenti ORF particles, TAF6L (Myc-DDK-tagged)-Human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF6L), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6L (NM_006473) Human Tagged ORF Clone
RC220716L4

USD 680.00

3 Weeks

Lenti-ORF clone of TAF6L (mGFP-tagged)-Human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF6L)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6L (NM_006473) Human Tagged ORF Clone Lentiviral Particle
RC220716L4V

USD 880.00

6 Weeks

Lenti ORF particles, TAF6L (mGFP-tagged)-Human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF6L), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6L (NM_006473) Human Tagged ORF Clone
RG220716

USD 530.00

3 Weeks

TAF6L (GFP-tagged) - Human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF6L)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Taf6l (NM_001107575) Rat Tagged ORF Clone
RR211457

USD 840.00

5 Weeks

Taf6l (Myc-DDK-tagged ORF) - Rat TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Taf6l (NM_001107575) Rat Tagged ORF Clone
RR211457L3

USD 1,040.00

9 Weeks

Lenti ORF clone of Taf6l (Myc-DDK-tagged ORF) - Rat TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_001107575) Rat Tagged ORF Clone Lentiviral Particle
RR211457L3V

USD 1,260.00

13 Weeks

Lenti ORF particles, Taf6l (Myc-DDK-tagged ORF) - Rat TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_001107575) Rat Tagged ORF Clone
RR211457L4

USD 1,130.00

9 Weeks

Lenti ORF clone of Taf6l (mGFP-tagged ORF) - Rat TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Taf6l (NM_001107575) Rat Tagged ORF Clone Lentiviral Particle
RR211457L4V

USD 1,400.00

13 Weeks

Lenti ORF particles, Taf6l (GFP-tagged ORF) - Rat TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6L Rabbit Polyclonal Antibody
TA347744

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6L Antibody: A synthesized peptide derived from human TAF6L
TAF6L Rabbit Polyclonal Antibody
TA315084

USD 345.00

In Stock

Rabbit polyclonal anti-TAF6L antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAF6L.
Taf6l (BC028647) Mouse Untagged Clone
MC206547

USD 210.00

In Stock

Taf6l (untagged) - Mouse TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (cDNA clone MGC:41377, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
TAF6L (NM_006473) Human Untagged Clone
SC111160

USD 1,050.00

In Stock

TAF6L (untagged)-Human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF6L)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Taf6l Rabbit Polyclonal Antibody
TA329306

USD 375.00

5 Days

Rabbit Polyclonal anti-Taf6l antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Taf6l antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS
TAF6L Rabbit Polyclonal Antibody
TA331161

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN
TAF6L Rabbit Polyclonal Antibody
TA343612

USD 310.00

5 Days

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN
TAF6L Rabbit Polyclonal Antibody
TA343613

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF6L antibody is: synthetic peptide directed towards the C-terminal region of Human TAF6L. Synthetic peptide located within the following region: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY
Human TAF6L activation kit by CRISPRa
GA107280

USD 1,290.00

2 Weeks

TAF6L CRISPRa kit - CRISPR gene activation of human TATA-box binding protein associated factor 6 like

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Taf6l activation kit by CRISPRa
GA213804

USD 1,290.00

2 Weeks

Taf6l CRISPRa kit - CRISPR gene activation of mouse TATA-box binding protein associated factor 6 like

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
TAF6L Human qPCR Primer Pair (NM_006473)
HP209417

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene TAF6L

Taf6l Mouse qPCR Primer Pair (NM_146092)
MP216578

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Taf6l

Taf6l (NM_001107575) Rat Untagged Clone
RN211457

USD 840.00

5 Weeks

Taf6l (untagged ORF) - Rat TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor (Taf6l), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TAF6L Human siRNA Oligo Duplex (Locus ID 10629)
SR307242

USD 430.00

2 Weeks

TAF6L (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Taf6l Mouse siRNA Oligo Duplex (Locus ID 225895)
SR418216

USD 430.00

2 Weeks

Taf6l (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Taf6l Rat siRNA Oligo Duplex (Locus ID 309194)
SR511169

USD 430.00

2 Weeks

Taf6l (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

TAF6L Rabbit Polyclonal Antibody
TA382286

USD 275.00

3 Weeks

TAF6L Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TAF6L (NP_006464.1).
Modifications Unmodified
TAF6L (NM_006473) ICC Control Block
TB420716

USD 1,130.00

4 Weeks

Transient overexpression of TAF6L (NM_006473) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAF6L Human shRNA Plasmid Kit (Locus ID 10629)
TL308956

USD 815.00

2 Weeks

TAF6L - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
TAF6L Human shRNA Lentiviral Particle (Locus ID 10629)
TL308956V

USD 1,395.00

5 Weeks

TAF6L - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Taf6l Mouse shRNA Plasmid (Locus ID 225895)
TL509859

USD 815.00

2 Weeks

Taf6l - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Taf6l Mouse shRNA Lentiviral Particle (Locus ID 225895)
TL509859V

USD 1,395.00

5 Weeks

Taf6l - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Taf6l Rat shRNA Plasmid (Locus ID 309194)
TL706129

USD 815.00

2 Weeks

Taf6l - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Taf6l Rat shRNA Lentiviral Particle (Locus ID 309194)
TL706129V

USD 1,395.00

5 Weeks

Taf6l - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
TAF6L Human shRNA Plasmid Kit (Locus ID 10629)
TR308956

USD 715.00

2 Weeks

TAF6L - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Taf6l Mouse shRNA Plasmid (Locus ID 225895)
TR509859

USD 715.00

2 Weeks

Taf6l - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS