Products

cDNA Clones (24)
RNAi (11)
Proteins (8)
Gene Expression (7)
Primary Antibodies (3)
Jump to Filters
View as table Download
TOX1 (TOX) Rabbit Polyclonal Antibody
TA319787

USD 430.00

5 Days

Rabbit Polyclonal TOX Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TOX antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human TOX.
TOX1 (TOX) Rabbit Polyclonal Antibody
TA334230

USD 375.00

5 Days

Rabbit Polyclonal Anti-TOX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOX antibody: synthetic peptide directed towards the N terminal of human TOX. Synthetic peptide located within the following region: CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP
TOX1 (TOX) Rabbit Polyclonal Antibody
TA355629

USD 360.00

5 Days

TOX Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human TOX