Products

cDNA Clones (31)
RNAi (12)
Proteins (8)
Gene Expression (6)
Primary Antibodies (5)
Jump to Filters
View as table Download
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 345.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335239

USD 375.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335240

USD 310.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
Ugt1a1 Rabbit Polyclonal Antibody
TA362943

USD 360.00

5 Days

UGT1A1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse UGT1A1
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA383073

USD 220.00

3 Weeks

UGT1A1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human UGT1A1 (NP_000454.1).
Modifications Unmodified