Products

RNAi (4)
Proteins (3)
Primary Antibodies (2)
Gene Expression (1)
cDNA Clones (1)
Jump to Filters
View as table Download
Tryptophanyl tRNA synthetase (WARS) Rabbit Polyclonal Antibody
TA332892

USD 275.00

2 Weeks

Rabbit anti-WARS Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WARS
Tryptophanyl tRNA synthetase (WARS) Rabbit Polyclonal Antibody
TA344288

USD 475.00

5 Days

Rabbit Polyclonal Anti-WARS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WARS antibody: synthetic peptide directed towards the N terminal of human WARS. Synthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF