Germany
Japan
United Kingdom
China
ACSM4 (Myc-DDK-tagged)-Human acyl-CoA synthetase medium-chain family member 4 (ACSM4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Acsm4 (Myc-DDK-tagged) - Mouse acyl-CoA synthetase medium-chain family member 4 (Acsm4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACSM4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN413310 is the updated version of KN213310.
Acsm4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500765 is the updated version of KN300765.
Acsm4 (GFP-tagged) - Mouse cDNA sequence BC048390 (BC048390)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acsm4 (Myc-DDK-tagged) - Mouse acyl-CoA synthetase medium-chain family member 4 (Acsm4)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acsm4 (Myc-DDK-tagged) - Mouse acyl-CoA synthetase medium-chain family member 4 (Acsm4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acsm4 (mGFP-tagged) - Mouse acyl-CoA synthetase medium-chain family member 4 (Acsm4)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acsm4 (GFP-tagged) - Mouse acyl-CoA synthetase medium-chain family member 4 (Acsm4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACSM4 (Myc-DDK tagged) - Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACSM4 (mGFP-tagged) - Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACSM4 (GFP-tagged) - Human acyl-CoA synthetase medium-chain family member 4 (ACSM4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acsm4 (Myc-DDK-tagged ORF) - Rat acyl-CoA synthetase medium-chain family member 4 (Acsm4), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acsm4 (Myc-DDK-tagged ORF) - Rat acyl-CoA synthetase medium-chain family member 4 (Acsm4), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acsm4 (Myc-DDK-tagged ORF) - Rat acyl-CoA synthetase medium-chain family member 4 (Acsm4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acsm4 (mGFP-tagged ORF) - Rat acyl-CoA synthetase medium-chain family member 4 (Acsm4), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acsm4 (GFP-tagged ORF) - Rat acyl-CoA synthetase medium-chain family member 4 (Acsm4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ACSM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSM4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACSM4. Synthetic peptide located within the following region: DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC |
ACSM4 CRISPRa kit - CRISPR gene activation of human acyl-CoA synthetase medium chain family member 4
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Acsm4 CRISPRa kit - CRISPR gene activation of mouse acyl-CoA synthetase medium-chain family member 4
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ACSM4
ACSM4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 4 (ACSM4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Acsm4 (untagged) - Mouse acyl-CoA synthetase medium-chain family member 4 (Acsm4), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Acsm4
ACSM4 MS Standard C13 and N15-labeled recombinant protein (NP_001073923)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Acsm4 (untagged ORF) - Rat acyl-CoA synthetase medium-chain family member 4 (Acsm4), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ACSM4 (untagged)-Human acyl-CoA synthetase medium-chain family member 4 (ACSM4)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ACSM4 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Acsm4 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Acsm4 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of ACSM4 (NM_001080454) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ACSM4 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ACSM4 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acsm4 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
BC048390 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acsm4 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Acsm4 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse acyl-CoA synthetase medium-chain family member 4 (Acsm4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
ACSM4 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Acsm4 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vectorr
| Format | Retroviral plasmids |
| Vector | pRS |
Acsm4 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of ACSM4 (NM_001080454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACSM4 (NM_001080454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACSM4