Germany
Japan
United Kingdom
China
CCL13 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 13 (CCL13)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CCL13 (GFP-tagged) - Human chemokine (C-C motif) ligand 13 (CCL13)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CCL13 (Myc-DDK tagged) - Human chemokine (C-C motif) ligand 13 (CCL13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CCL13 (mGFP-tagged) - Human chemokine (C-C motif) ligand 13 (CCL13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13 / MCP-4)
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13).
| Tag | Tag Free |
| Expression Host | E. coli |
Transient overexpression lysate of chemokine (C-C motif) ligand 13 (CCL13)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (CCL13)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Homo sapiens gene CCL13
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
CCL13 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (cDNA clone MGC:17134 IMAGE:4184250), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CCL13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL13 antibody: synthetic peptide directed towards the middle region of human CCL13. Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 10 µg
| Tag | His-tag |
| Expression Host | E. coli |
Human CCL13/MCP4 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human CCL13/MCP4 |
| Reactivities | Human |
CCL13 CRISPRa kit - CRISPR gene activation of human C-C motif chemokine ligand 13
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CCL13
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene CCL13
| Application | Plasmid of exact quantity for transcript copy number calculation |
CCL13 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CCL13 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
CCL13 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
CCL13 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CCL13