Germany
Japan
United Kingdom
China
CYP2C19 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 850.00
3 Weeks
Lenti ORF particles, CYP2C19 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 850.00
6 Weeks
Lenti ORF particles, CYP2C19 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYP2C19 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 850.00
7 Weeks
Lenti ORF particles, CYP2C19 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 850.00
3 Weeks
Lenti ORF particles, CYP2C19 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP2C19 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CYP2C19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD |
Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19 |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene CYP2C19
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
USD 187.00
In Stock
CYP2C19 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 605.00
In Stock
Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CYP2C19 CRISPRa kit - CRISPR gene activation of human cytochrome P450 family 2 subfamily C member 19
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CYP2C19
| Application | Plasmid of exact quantity for transcript copy number calculation |
CYP2C19 MS Standard C13 and N15-labeled recombinant protein (NP_000760)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CYP2C19 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
CYP2C19 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP2C19 |
Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CYP2C19 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
USD 1,395.00
5 Weeks
CYP2C19 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
CYP2C19 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP2C19