Products

View as table Download

Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Tag C-Myc/DDK
Expression Host HEK293T

CYP2C19 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CYP2C19 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP2C19 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CYP2C19 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-CYP2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD

Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19

Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of Human CYP2C19.

Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

qSTAR qPCR primer pairs against Homo sapiens gene CYP2C19

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

CYP2C19 CRISPRa kit - CRISPR gene activation of human cytochrome P450 family 2 subfamily C member 19

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene CYP2C19

Application Plasmid of exact quantity for transcript copy number calculation

CYP2C19 MS Standard C13 and N15-labeled recombinant protein (NP_000760)

Tag C-Myc/DDK
Expression Host HEK293

CYP2C19 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

CYP2C19 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP2C19

Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CYP2C19 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

CYP2C19 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin

Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack